DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and CG1503

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285511.1 Gene:CG1503 / 33090 FlyBaseID:FBgn0031157 Length:307 Species:Drosophila melanogaster


Alignment Length:250 Identity:84/250 - (33%)
Similarity:131/250 - (52%) Gaps:20/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QNQNTNRRRPRFTNNSFHTKMGSN------SKADPISLTFHDSCLRMSDVQLLHGPH-WLNDQIL 72
            :.:|.|:.|...|:.|...:.||.      ::...::|.|.|..||.||||||...: .:|::::
  Fly    53 KGKNKNKIRDSKTSTSLALERGSGDGPHQLAEVSLVALRFMDISLRHSDVQLLQSANEGVNERLV 117

  Fly    73 SFYYEYLAHMKYKTNADLHFIAPEITQCMKYMGDQELKQLLDQSNTTGKPFIFFALNDNETTDAG 137
            :|||.||.|.:|::..||||:.|.:...:::|..::|..::.......|.||...|:   |....
  Fly   118 AFYYAYLQHRRYRSELDLHFLNPGLAARLRHMNMRQLWAMVRDRRLNEKQFILVPLS---THPRP 179

  Fly   138 GSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLELMNKIKDLLGVRMAKFRPMRCLQQ--------A 194
            ..||||||.|||:..|||:||..|.::..:..:...::..|..........|||||        .
  Fly   180 HGHWSLLVISRPDSKFYHYDSLDNCHSPLAASVSETLRAPLEAWKFALVTGRCLQQERQAAGKEG 244

  Fly   195 NGYD--CGIHVICMTDHIADYLNRYEVIDGLPSLHIDTVKAKRTELLKLILSLGG 247
            :|.|  .|||::|||||:|||:.|.........:.:|.:.|.||.|::||.||||
  Fly   245 SGRDPASGIHLMCMTDHVADYVARCGYATSSLLIAVDQIAAMRTHLVELIQSLGG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 46/147 (31%)
CG1503NP_001285511.1 Peptidase_C48 117..>205 CDD:304959 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2828
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2191
Isobase 1 0.950 - 0 Normalized mean entropy S3849
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.