DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and Ulp1

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_573362.1 Gene:Ulp1 / 32910 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:64/171 - (37%) Gaps:38/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WLNDQILSFYYEYLAHMKYKTNADL-------HFIAPEITQCMKYMGDQELKQLLDQSNTTGKPF 123
            ||||.|::||...|.....|...:|       .|..|.:.|. .|.|.:...:.:|..:....|.
  Fly  1332 WLNDAIINFYMSMLTERSEKRAGELPATYAMNTFFMPRLLQA-GYAGVRRWTRKVDLFSKDIIPV 1395

  Fly   124 IFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYGNNNT-----------GNSLELMNKIKDL 177
                     ....|..||.:.:.....||.:::||.|..|.           ..||:...:..|:
  Fly  1396 ---------PVHCGNVHWCMAIIHLRNKTIFYYDSMGRPNQPALDALVKYLHEESLDKRKQPFDM 1451

  Fly   178 LG--VRMAKFRPMRCLQQANGYDCGIHVICMTDHIADYLNR 216
            .|  |..|:..|    :|.|..|||: ..||   .|:|:.|
  Fly  1452 TGFVVENAQNIP----RQGNSSDCGV-FSCM---FAEYITR 1484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 38/157 (24%)
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 43/171 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12606
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.