DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and CG32110

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster


Alignment Length:281 Identity:64/281 - (22%)
Similarity:107/281 - (38%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HDRKILRQHTRQNQNTNRRRPRFTNNSFHT--KMGSNSKADPISLTFHDSCLRM----------- 55
            |...:..:|.|.....:|.:......|.|.  .:..:|:..|::...||..:.:           
  Fly   147 HQLCLKAKHERIACEIDRYKKLILKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYPLQQVIVA 211

  Fly    56 --------SDVQLLHGPHWLNDQILSFYYEYLAHMKYK-------TNADLHFIAPEITQCMKYMG 105
                    ||:::|....||||:|::||...|.....|       ..|...|..|.:.|    .|
  Fly   212 KFNLDICGSDIKILTSGGWLNDKIINFYMNLLVERSEKRPGTVPSVYAMSTFFVPRLLQ----SG 272

  Fly   106 DQELKQLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLEL 170
            ...:|:...:.:......|...::....      ||.|::...|.||..:::|.|..:......|
  Fly   273 FDGVKRWTRKVDLFSMDLILVPVHQMLV------HWCLVIIDLPAKTMLYYNSRGRGDPNLMRAL 331

  Fly   171 MNKI----KDLLGVRM--AKFR---PMRCLQQANGYDCGIHVICMTDHIADYLNRYEVIDGLPSL 226
            :..:    :|.||:.:  ::||   .....||.|..|||:.| ||   .|:||.|    |...:.
  Fly   332 VKYLQMESEDKLGLCLDTSEFRIEDAQNVPQQDNMNDCGVFV-CM---FAEYLTR----DAPITF 388

  Fly   227 HIDTVKAKRTELLKLILSLGG 247
            ....:|..||   |::|.|.|
  Fly   389 SKKDMKYFRT---KMVLELTG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 36/153 (24%)
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 47/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12606
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.