DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and nep1

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_596375.2 Gene:nep1 / 2539808 PomBaseID:SPBC17D11.01 Length:420 Species:Schizosaccharomyces pombe


Alignment Length:183 Identity:56/183 - (30%)
Similarity:82/183 - (44%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ADPISLTFHDSCLRMSDVQLLHGPHWLNDQILSFYYEYLAHM---KYKTNAD--------LHFIA 94
            :.|..|...|.|.:..||..|..|:|..|..:.:..|.:.|:   .|...|:        |.|:.
pombe     3 SSPTVLELFDVCFKQEDVDSLKKPNWFTDVSIDYVDELIEHLWFPSYPNQANEILLLRPSLVFLL 67

  Fly    95 PEITQCMKYMGDQELKQLLDQSNTTGKPFIFFALN--DNETTDAGGSHWSLLVFSRPEKTFYHFD 157
            .|..     :..:|||..|.:.....| ::|..:|  |.....:|||||||:|.|.|:...|::|
pombe    68 AEAA-----ISPEELKVALPKKLMNCK-YLFMPINDLDKHAAGSGGSHWSLMVASIPDGQCYYYD 126

  Fly   158 SYGNNNTGNSLELMNKIKDLLGVRMAKFRPMRCL---QQANGYDCGIHVICMT 207
            |..|..|.:....:.::.||.   ..|| .:.|:   ||.||||||.||...|
pombe   127 SLSNGKTKDCRSALARVSDLF---KKKF-TIECMPVQQQRNGYDCGAHVCAFT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 46/153 (30%)
nep1NP_596375.2 Peptidase_C48 27..217 CDD:304959 48/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2753
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 1 1.000 - - otm47140
orthoMCL 1 0.900 - - OOG6_103852
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R806
SonicParanoid 1 1.000 - - X4159
TreeFam 1 0.960 - -
98.700

Return to query results.
Submit another query.