DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and SENP8

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001159812.1 Gene:SENP8 / 123228 HGNCID:22992 Length:212 Species:Homo sapiens


Alignment Length:211 Identity:77/211 - (36%)
Similarity:121/211 - (57%) Gaps:4/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DPISLTFHDSCLRMSDVQLLHGPHWLNDQILSFYYEYLAHMKYKTNAD-LHFIAPEITQCMKYMG 105
            ||:.|::.||.||.|||.||..|.||||.|:.|.:||.|:.::...:| :.||:||:||.:|...
Human     2 DPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTS 66

  Fly   106 D-QELKQLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLE 169
            : .|:...|:..:...|..:|.|:|||....|||:||||||:.:.:.:|:|:||:..:|:.::.:
Human    67 NPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQ 131

  Fly   170 LMNKIKDLLGVRMAK--FRPMRCLQQANGYDCGIHVICMTDHIADYLNRYEVIDGLPSLHIDTVK 232
            :..|::..||.:..|  |...:...|.|.||||::|||.|:.:.....|.:....|..|....:.
Human   132 VAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYIT 196

  Fly   233 AKRTELLKLILSLGGK 248
            .||.|...||.:|..|
Human   197 KKRGEWKDLITTLAKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 50/141 (35%)
SENP8NP_001159812.1 Protease 11..174 63/162 (39%)
Peptidase_C48 26..174 CDD:420019 54/147 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159393
Domainoid 1 1.000 109 1.000 Domainoid score I6399
eggNOG 1 0.900 - - E1_COG2828
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14084
Inparanoid 1 1.050 139 1.000 Inparanoid score I4521
Isobase 1 0.950 - 0 Normalized mean entropy S3849
OMA 1 1.010 - - QHG54524
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 1 1.000 - - oto89220
orthoMCL 1 0.900 - - OOG6_103852
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R806
SonicParanoid 1 1.000 - - X4159
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.650

Return to query results.
Submit another query.