DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Den1 and senp8

DIOPT Version :9

Sequence 1:NP_001163126.1 Gene:Den1 / 36339 FlyBaseID:FBgn0033716 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001120583.1 Gene:senp8 / 100145737 XenbaseID:XB-GENE-959844 Length:215 Species:Xenopus tropicalis


Alignment Length:209 Identity:68/209 - (32%)
Similarity:114/209 - (54%) Gaps:5/209 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DPISLTFHDSCLRMSDVQLLHGPHWLNDQILSFYYEYLAHMKYKTNA-DLHFIAPEITQCMKYMG 105
            :.:.::|.|:.||.|||.||..||||||.|:.|.:|:|:.......| .:.|::||::|.:|..|
 Frog     2 EKVVVSFGDALLRSSDVALLDPPHWLNDNIIGFTFEFLSSSLPPLQAQQVSFLSPEVSQFIKCCG 66

  Fly   106 DQELKQLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYGNNNTGNSLEL 170
            : |....|:..:...|..:...:|||...:|||:|||||.:.|....|.|:||....|..:: .|
 Frog    67 N-EASDFLEPLDLPSKELVLIPVNDNTGPEAGGTHWSLLAYVRRYTVFLHYDSSPGTNAPHA-RL 129

  Fly   171 MNKIKDLLGVRMAKFRPMRCLQQANGYDCGIHVICMTDHIAD-YLNRYEVIDGLPSLHIDTVKAK 234
            |.|..|:|......:|......|.|.||||::|:|:.:.::: :|:.::.: .|.::....|..|
 Frog   130 MAKNLDVLLGGKQNYREEDAPVQHNSYDCGMYVVCVAEALSEQHLHGHDSM-FLRNITPQFVTQK 193

  Fly   235 RTELLKLILSLGGK 248
            |.:..::|..|..|
 Frog   194 RVKWKEIIKGLSCK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Den1NP_001163126.1 Peptidase_C48 66..204 CDD:304959 47/138 (34%)
senp8NP_001120583.1 ULP1 <17..171 CDD:227489 55/155 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7631
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14084
Inparanoid 1 1.050 112 1.000 Inparanoid score I4722
OMA 1 1.010 - - QHG54524
OrthoDB 1 1.010 - - D1313098at2759
OrthoFinder 1 1.000 - - FOG0004372
OrthoInspector 1 1.000 - - oto103059
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R806
SonicParanoid 1 1.000 - - X4159
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.