DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and CYTH2

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_006723535.1 Gene:CYTH2 / 9266 HGNCID:9502 Length:421 Species:Homo sapiens


Alignment Length:269 Identity:90/269 - (33%)
Similarity:149/269 - (55%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 APATGGSRHSRHNSGLEGIVIDSGNSVAAEEK--VENI---ASFINASSHRLR---LQSGGEGVG 631
            :|||.....| .|.||.  .:.....:..||:  :|||   ...:.....|||   .::..|..|
Human    10 SPATSPVMES-ENQGLS--PLPKPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEG 71

  Fly   632 ITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIG 696
            :.:.:.:|..|:.|.::.|.::||..|:||||:|.|:.:|  :..|.::|.||.:..||:|..||
Human    72 LEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELL--QNTPEEIARFLYKGEGLNKTAIG 134

  Fly   697 EYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQD 761
            :|:.:::.::..:|..|||..:||.|.:.||||.:|.:|||||||..|..::|.|:..:...|..
Human   135 DYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPG 199

  Fly   762 PFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIK 826
            .|.:.|..:.|::|:||||...||.|.:  :.| .||.|....||:|.|.|..:|:|..::::|:
Human   200 VFQSTDTCYVLSFAVIMLNTSLHNPNVR--DKP-GLERFVAMNRGINEGGDLPEELLRNLYDSIR 261

  Fly   827 NEEIVMPAE 835
            ||...:|.:
Human   262 NEPFKIPED 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 90/269 (33%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 70/186 (38%)
CYTH2XP_006723535.1 Sec7 83..265 CDD:396096 70/186 (38%)
PH_GRP1-like 280..399 CDD:269954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.