Sequence 1: | NP_610761.2 | Gene: | garz / 36337 | FlyBaseID: | FBgn0264560 | Length: | 1983 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004218.1 | Gene: | CYTH3 / 9265 | HGNCID: | 9504 | Length: | 399 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 76/204 - (37%) |
---|---|---|---|
Similarity: | 122/204 - (59%) | Gaps: | 5/204 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 632 ITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIG 696
Fly 697 EYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQD 761
Fly 762 PFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIK 826
Fly 827 NEEIVMPAE 835 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
garz | NP_610761.2 | COG5307 | 346..>1062 | CDD:227623 | 76/204 (37%) |
Sec7_N | 370..512 | CDD:289549 | |||
Sec7 | 643..830 | CDD:279680 | 71/186 (38%) | ||
CYTH3 | NP_004218.1 | Sec7 | 66..248 | CDD:396096 | 71/186 (38%) |
PH_GRP1-like | 263..382 | CDD:269954 | |||
C-terminal autoinhibitory region. /evidence=ECO:0000269|PubMed:23940353 | 391..399 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148857 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5307 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |