Sequence 1: | NP_610761.2 | Gene: | garz / 36337 | FlyBaseID: | FBgn0264560 | Length: | 1983 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082471.2 | Gene: | Cyth4 / 72318 | MGIID: | 2441702 | Length: | 393 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 75/205 - (36%) |
---|---|---|---|
Similarity: | 119/205 - (58%) | Gaps: | 5/205 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 634 SEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEY 698
Fly 699 ISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPF 763
Fly 764 ANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNE 828
Fly 829 EIVMPAEQTG 838 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
garz | NP_610761.2 | COG5307 | 346..>1062 | CDD:227623 | 75/205 (37%) |
Sec7_N | 370..512 | CDD:289549 | |||
Sec7 | 643..830 | CDD:279680 | 71/186 (38%) | ||
Cyth4 | NP_082471.2 | Sec7 | 61..243 | CDD:279680 | 71/186 (38%) |
PH_GRP1-like | 258..376 | CDD:269954 | |||
PH | 262..374 | CDD:278594 | |||
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 | 268..275 | ||||
C-terminal autoinhibitory region. /evidence=ECO:0000250 | 386..393 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5307 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |