DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and Cyth4

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_082471.2 Gene:Cyth4 / 72318 MGIID:2441702 Length:393 Species:Mus musculus


Alignment Length:205 Identity:75/205 - (36%)
Similarity:119/205 - (58%) Gaps:5/205 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 SEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEY 698
            |.:.:::.||::.:..|.::||..|.||||||.||.:|.:  |...:|.||.:..||:|..||.|
Mouse    52 STEESRMAQKEKEMCIGRKKFNMDPNKGIQYLIEHKLLTS--DVQDIAQFLYKGDGLNKTAIGTY 114

  Fly   699 ISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPF 763
            :.:|..::.::|..|||..:|..|.:.||||.:|.:|||||||..|..::|.|:..:...|...|
Mouse   115 LGEKDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAARYCLCNPGVF 179

  Fly   764 ANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNE 828
            .:.|..:.|::::||||...||.|.:  :.| ..|.|....||:|.|.|..:|.|..:|::||:|
Mouse   180 RSTDTCYVLSFSVIMLNTGLHNPNVR--DRP-PFERFVTMNRGINSGSDLPEEQLRNLFDSIKSE 241

  Fly   829 EIVMPAEQTG 838
            ...:|.:..|
Mouse   242 PFSIPEDDGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 75/205 (37%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 71/186 (38%)
Cyth4NP_082471.2 Sec7 61..243 CDD:279680 71/186 (38%)
PH_GRP1-like 258..376 CDD:269954
PH 262..374 CDD:278594
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 268..275
C-terminal autoinhibitory region. /evidence=ECO:0000250 386..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.