DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and cyth2

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_005157903.1 Gene:cyth2 / 569358 ZFINID:ZDB-GENE-100921-55 Length:416 Species:Danio rerio


Alignment Length:203 Identity:78/203 - (38%)
Similarity:122/203 - (60%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 TSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGE 697
            ||.:.:|..||.|.::.|.::||..|:|||.:|.|:.:|..  .|..:|.||.:..||:|..||:
Zfish    68 TSTEGSKTLQKSRHVAMGRKKFNMDPKKGIVFLVENELLRH--TPEDIAQFLYKGEGLNKTAIGD 130

  Fly   698 YISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDP 762
            |:.::.:.:.|:|..|||..:||.|.:.||||.:|.:|||||||..|..::|.|:..:...|...
Zfish   131 YLGERDDFNIKVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGV 195

  Fly   763 FANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKN 827
            |.:.|..:.|::||||||...||.|.:  :.| |:|.|....||:|.|.|..:|:|..::::|||
Zfish   196 FQSTDTCYVLSFAIIMLNTSLHNPNVR--DKP-TVERFISMNRGINDGGDLPEELLRNLYDSIKN 257

  Fly   828 EEIVMPAE 835
            |...:|.:
Zfish   258 EPFKIPED 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 78/203 (38%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 73/186 (39%)
cyth2XP_005157903.1 Sec7 78..260 CDD:279680 73/186 (39%)
PH_GRP1-like 275..394 CDD:269954
PH 279..392 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582790
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.