Sequence 1: | NP_610761.2 | Gene: | garz / 36337 | FlyBaseID: | FBgn0264560 | Length: | 1983 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157903.1 | Gene: | cyth2 / 569358 | ZFINID: | ZDB-GENE-100921-55 | Length: | 416 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 78/203 - (38%) |
---|---|---|---|
Similarity: | 122/203 - (60%) | Gaps: | 5/203 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 633 TSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGE 697
Fly 698 YISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDP 762
Fly 763 FANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKN 827
Fly 828 EEIVMPAE 835 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
garz | NP_610761.2 | COG5307 | 346..>1062 | CDD:227623 | 78/203 (38%) |
Sec7_N | 370..512 | CDD:289549 | |||
Sec7 | 643..830 | CDD:279680 | 73/186 (39%) | ||
cyth2 | XP_005157903.1 | Sec7 | 78..260 | CDD:279680 | 73/186 (39%) |
PH_GRP1-like | 275..394 | CDD:269954 | |||
PH | 279..392 | CDD:278594 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582790 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5307 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |