DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and PSD

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_001257894.1 Gene:PSD / 5662 HGNCID:9507 Length:1024 Species:Homo sapiens


Alignment Length:610 Identity:139/610 - (22%)
Similarity:224/610 - (36%) Gaps:189/610 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 DSGNSVAA---------EEKVENIASFINASSHRLRLQSGGE-----------GVG--------- 631
            |||.|.||         ||:.|          .|.:|..|.|           |:|         
Human   467 DSGTSSAADGPWTQRGEEEEAE----------ARAKLAPGREPPSPCHSEDSLGLGAAPLGSEPP 521

  Fly   632 ---ITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQ---VALFLRENPGL 690
               :.|:..:::...:||....|:..:...:..::..|........||..:   ||..|.:|...
Human   522 LSQLVSDSDSELDSTERLALGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDF 586

  Fly   691 DKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHW 755
            .|.:.|||:.               .|.|||:.:|||||::|:...|.||......||.|||..:
Human   587 SKLVAGEYLK---------------FFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRY 636

  Fly   756 HKQNQDPFANVDAAFRLAYAIIMLNMDQHNSN-AKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLA 819
            .:.|.:..::.|.|..|..|:::||.|.|..| .||    ||..||..||.|||.|.||.:|:|.
Human   637 FQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKR----MTCGDFIGNLEGLNDGGDFPRELLK 697

  Fly   820 QVFNAIKNEEIVMPAEQTGLVRENYQWKVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSAL 884
            .::::||||::              ||.:     |..:........|..:.::...:.|.|.|..
Human   698 ALYSSIKNEKL--------------QWAI-----DEEELRRSLSELADPNPKVIKRISGGSGSGS 743

  Fly   885 SFMFDKSTETGYQRTLAGFSKSAAISAH----YNLHSDFDALVLTLCKFT--------------- 930
            |...|.:.|.|           ||:..|    ..:|:|.|      |:.|               
Human   744 SPFLDLTPEPG-----------AAVYKHGALVRKVHADPD------CRKTPRGKRGWKSFHGILK 791

  Fly   931 --TLLSSVEQHEPAPANNETQQ----AVNFGLNGKAQAAMR---TVFLLVHDYGDCL-------- 978
              .|....|:::|..|.:||:.    :::..|..:|....:   ..:|...|:...|        
Human   792 GMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQ 856

  Fly   979 RESWKHILDLYLQLFRLKLLPKSLIEVEDFC--------------------EANGKAMLI-LEKP 1022
            .:||...:::...:|.....|.::...:.|.                    ||..|||.. |.:.
Human   857 MQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREH 921

  Fly  1023 REKQESGLFSSLYSFISSEGQREPTYEEQDFIKLGRKCIKECQLDQMLQESKF--------VQLE 1079
            |..|           :..:|:.:...|::.         ||..|:  .::|::        |:|:
Human   922 RAAQ-----------LGKKGRGKEAEEQRQ---------KEAYLE--FEKSRYSTYAALLRVKLK 964

  Fly  1080 SLQELLKCVLALLKAPQGHKSIGLP 1104
            :..|.|..|.|.| |..|....|||
Human   965 AGSEELDAVEAAL-AQAGSTEDGLP 988

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 123/558 (22%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 62/190 (33%)
PSDNP_001257894.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..98
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..402
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..536 16/78 (21%)
Sec7 542..708 CDD:238100 60/184 (33%)
PH_EFA6 753..877 CDD:270107 23/140 (16%)
PH 757..865 CDD:278594 19/113 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 976..1024 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.