DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and Cyth4

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_017450546.1 Gene:Cyth4 / 500906 RGDID:1564842 Length:411 Species:Rattus norvegicus


Alignment Length:202 Identity:74/202 - (36%)
Similarity:118/202 - (58%) Gaps:5/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 SEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEY 698
            |.:.:::.||::.:..|.::||..|.||||||.||.:|.:  |...:|.||.:..||:|..||.|
  Rat    69 STEESRMAQKEKEMCIGRKKFNMDPAKGIQYLTEHKLLTS--DVQDIAQFLYKGEGLNKTAIGTY 131

  Fly   699 ISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPF 763
            :.:|..::.::|..|||..:|..|.:.||||.:|.:|||||||..|..::|.|:..:...|...|
  Rat   132 LGEKDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAARYCLCNPGVF 196

  Fly   764 ANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNE 828
            .:.|..:.|::::||||...||.|.:  :.| ..|.|....||:|.|.|..:|.|..:|::||:|
  Rat   197 RSTDTCYVLSFSVIMLNTGLHNPNVR--DRP-HFEHFVSMNRGINSGSDLPEEQLRNLFDSIKSE 258

  Fly   829 EIVMPAE 835
            ...:|.:
  Rat   259 PFSIPED 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 74/202 (37%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 71/186 (38%)
Cyth4XP_017450546.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.