DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and Cyth3

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_035312.3 Gene:Cyth3 / 19159 MGIID:1335107 Length:399 Species:Mus musculus


Alignment Length:204 Identity:76/204 - (37%)
Similarity:123/204 - (60%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 ITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIG 696
            :||.:.:|..|:.:.::.|.::||..|:||||:|.|:.:|.:  .|..||.||.:..||:|.:||
Mouse    55 LTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQS--SPEDVAQFLYKGEGLNKTVIG 117

  Fly   697 EYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQD 761
            :|:.::.:.:.|:|..||:..:|..|.:.||||.:|.:|||||||..|..::|.|:..:...|..
Mouse   118 DYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPG 182

  Fly   762 PFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIK 826
            .|.:.|..:.|::||||||...||.|.:  :.| |.|.|....||:|.|.|..:|:|..::.:||
Mouse   183 VFQSTDTCYVLSFAIIMLNTSLHNHNVR--DKP-TAERFITMNRGINEGGDLPEELLRNLYESIK 244

  Fly   827 NEEIVMPAE 835
            ||...:|.:
Mouse   245 NEPFKIPED 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 76/204 (37%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 71/186 (38%)
Cyth3NP_035312.3 Sec7 66..248 CDD:396096 71/186 (38%)
PH_GRP1-like 263..382 CDD:269954
Phosphatidylinositol 3,4,5-trisphosphate binding 273..280
C-terminal autoinhibitory region 391..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.