DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and Cyth2

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_035311.1 Gene:Cyth2 / 19158 MGIID:1334255 Length:400 Species:Mus musculus


Alignment Length:219 Identity:78/219 - (35%)
Similarity:131/219 - (59%) Gaps:8/219 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   620 RLR---LQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVA 681
            |||   .::..|..|:.:.:.:|..|:.|.::.|.::||..|:||||:|.||.:|  :..|.::|
Mouse    35 RLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELL--QNTPEEIA 97

  Fly   682 LFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFL 746
            .||.:..||:|..||:|:.:::.::..:|..|||..:||.|.:.||||.:|.:|||||||..|..
Mouse    98 RFLYKGEGLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDR 162

  Fly   747 VLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGE 811
            ::|.|:..:...|...|.:.|..:.|::|:||||...||.|.:  :.| .||.|....||:|.|.
Mouse   163 MMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVR--DKP-GLERFVAMNRGINEGG 224

  Fly   812 DFDQEMLAQVFNAIKNEEIVMPAE 835
            |..:::|..::::|:||...:|.:
Mouse   225 DLPEDLLRNLYDSIRNEPFKIPED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 78/219 (36%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 70/186 (38%)
Cyth2NP_035311.1 Sec7 61..243 CDD:396096 70/186 (38%)
PH_GRP1-like 258..378 CDD:269954
C-terminal autoinhibitory region. /evidence=ECO:0000250 387..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.