DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and Cyth1

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_446362.1 Gene:Cyth1 / 116691 RGDID:620397 Length:398 Species:Rattus norvegicus


Alignment Length:247 Identity:87/247 - (35%)
Similarity:141/247 - (57%) Gaps:17/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 NSVAAEEK--VENI---ASFINASSHRLR-----LQSGGEGVGITSEQLAKVKQKKRLLSQGTER 653
            :.:.|||:  :|||   ...:.|...||:     :.:..|.:|.|.|:  |..|:.:.::.|.::
  Rat    10 SDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEER--KNMQRNKQVAMGRKK 72

  Fly   654 FNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFD 718
            ||..|:||||:|.|:|:|....:  .:|.||.:..||:|..||:|:.::.....::|..||:..:
  Rat    73 FNMDPKKGIQFLIENGLLKNTCE--DIAQFLYKGEGLNKTAIGDYLGERDEFSIQVLHAFVELHE 135

  Fly   719 FTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQ 783
            ||.|.:.||||.:|.:|||||||..|..::|.|:..:.:.|...|.:.|..:.|::||||||...
  Rat   136 FTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVFQSTDTCYVLSFAIIMLNTSL 200

  Fly   784 HNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAE 835
            ||.|.|  :.| |:|.|....||:|.|.|..:|:|..::.:||||...:|.:
  Rat   201 HNPNVK--DKP-TVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 87/247 (35%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 71/186 (38%)
Cyth1NP_446362.1 Sec7 62..244 CDD:307500 71/186 (38%)
PH_GRP1-like 259..379 CDD:269954
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 269..277
C-terminal autoinhibitory region. /evidence=ECO:0000250 388..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.