DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and LOC101886286

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_005169554.1 Gene:LOC101886286 / 101886286 -ID:- Length:297 Species:Danio rerio


Alignment Length:310 Identity:66/310 - (21%)
Similarity:108/310 - (34%) Gaps:92/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1161 AVLK-LAIYLMRNE-----ELCPIVLQSLKMLLMLKPALLLR---ISKQISIGIYELLKTS---- 1212
            |||| |.:||.:.|     :|..   :.||..:.:..:|.:|   .||:.:: .|  |:|:    
Zfish    44 AVLKGLILYLQKGEYRPDKQLSD---EDLKNAVSIHHSLAIRATDYSKRPNV-FY--LRTADWRV 102

  Fly  1213 ----AQNIHSEQDWQIIFNLLECVGAGAVPPNYDDAQ----LPLPPNGSAKSDGAISGEEDATAV 1269
                |.|....|.|....|.:..:.:....|....:|    .||.|..::|    :|.||...|.
Zfish   103 YLFQAPNAEQMQSWITRINTVAAMFSAPPLPAAIGSQKKFSRPLLPGSASK----LSQEEQVQAH 163

  Fly  1270 PERGYTSDSEITKASAAP---AVSSPSAENWILVNNKDSELTTASRPQSPPSLSAPPVNTLVYNC 1331
            ..|..:..:|:.:..:.|   .|.....|.:.|..                              
Zfish   164 ETRFRSISTELAQLRSYPPDRKVKGRELEEYRLRE------------------------------ 198

  Fly  1332 QLLDHAPFALFKCWDSLAFIVRSVAHITPYNFEACVRC----IRIFVEACRDGGIRQRRKLESAA 1392
               ::..|...: :::.:.::|           |..||    :.:|.....:.|..||.: .|..
Zfish   199 ---EYLEFEKTR-YETYSMLLR-----------AKQRCGDDDLSVFEAMLLEEGALQRAQ-SSPT 247

  Fly  1393 KQKSSKKRSERKPGMASSASSSNLTLLTGDPSDNQINGNAAEQEDLAQRY 1442
            .|.||...|.|     ..||.|..|....:||.|..||.:..|   .||:
Zfish   248 LQDSSLTCSTR-----DGASPSTTTAAPPEPSGNGNNGCSRGQ---GQRH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680
LOC101886286XP_005169554.1 PH_EFA6 11..133 CDD:270107 23/94 (24%)
PH 13..121 CDD:278594 22/82 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.