Sequence 1: | NP_610761.2 | Gene: | garz / 36337 | FlyBaseID: | FBgn0264560 | Length: | 1983 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021330428.1 | Gene: | cyth3b / 100537448 | ZFINID: | ZDB-GENE-130530-529 | Length: | 396 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 74/206 - (35%) |
---|---|---|---|
Similarity: | 122/206 - (59%) | Gaps: | 10/206 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 635 EQL-----AKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKM 694
Fly 695 IGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQN 759
Fly 760 QDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNA 824
Fly 825 IKNEEIVMPAE 835 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
garz | NP_610761.2 | COG5307 | 346..>1062 | CDD:227623 | 74/206 (36%) |
Sec7_N | 370..512 | CDD:289549 | |||
Sec7 | 643..830 | CDD:279680 | 68/186 (37%) | ||
cyth3b | XP_021330428.1 | Sec7 | 63..245 | CDD:307500 | 68/186 (37%) |
PH_GRP1-like | 260..379 | CDD:269954 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582796 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |