DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and cyth3b

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_021330428.1 Gene:cyth3b / 100537448 ZFINID:ZDB-GENE-130530-529 Length:396 Species:Danio rerio


Alignment Length:206 Identity:74/206 - (35%)
Similarity:122/206 - (59%) Gaps:10/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   635 EQL-----AKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKM 694
            |||     :|..|:.:.::.|.::||..|:||||:|.|:.:|  :..|..:|.||.:..||:|.:
Zfish    50 EQLTCVGESKTTQRNKQIAMGRKKFNMDPKKGIQFLLENDLL--QQTPEDIAQFLYKGEGLNKTV 112

  Fly   695 IGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQN 759
            ||:|:.::...:.|:|..||:..:|..|.:.||||.:|.:|||||||..|..::|.|:..:.:.|
Zfish   113 IGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCN 177

  Fly   760 QDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNA 824
            ...|.:.|..:.|::||||||...||.|.:  :.| .:|.|....||:|.|.|..:|:|..::.:
Zfish   178 PGVFQSTDTCYVLSFAIIMLNTSLHNPNVR--DKP-AVERFISMNRGINDGGDLPEELLRNLYES 239

  Fly   825 IKNEEIVMPAE 835
            ||:|...:|.:
Zfish   240 IKSEPFKIPED 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 74/206 (36%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 68/186 (37%)
cyth3bXP_021330428.1 Sec7 63..245 CDD:307500 68/186 (37%)
PH_GRP1-like 260..379 CDD:269954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.