DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and cyth1

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_004916381.1 Gene:cyth1 / 100379752 XenbaseID:XB-GENE-986107 Length:405 Species:Xenopus tropicalis


Alignment Length:235 Identity:81/235 - (34%)
Similarity:133/235 - (56%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 EEKVENIASFINASSHRLR---LQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYL 665
            :|.:|.|        .|||   .::..|..|:.:.:.:|..|:.|.:..|.::||..|:|||.||
 Frog    27 QELLEEI--------QRLRDELSEAMNEVEGLEANEGSKTLQRNRKMGMGRKKFNMDPKKGIVYL 83

  Fly   666 QEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQALRL 730
            ||:.:|..  .|..:|.||.:..||:|..||:|:.::.:.:..:|.:|||..:||.|.:.||||.
 Frog    84 QENELLRN--TPEDIARFLYKGEGLNKTAIGDYLGERDDFNISVLHSFVDLHEFTDLNLVQALRQ 146

  Fly   731 YLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPM 795
            :|.:|||||||..|..::|.|:..:...|...|.:.|..:.|::|:||||...||.|.:  :.| 
 Frog   147 FLWSFRLPGEAQKIDRMMEAFAQRYCICNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVR--DKP- 208

  Fly   796 TLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAE 835
            .:|.|....||:|.|.|..:|:|..::::|:||...:|.:
 Frog   209 GVERFISMNRGINDGGDLPEELLRNLYDSIRNEPFKIPED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 81/235 (34%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 70/186 (38%)
cyth1XP_004916381.1 Sec7 61..243 CDD:366596 70/186 (38%)
PH_GRP1-like 258..377 CDD:269954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.