DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and fbxo8

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_001120293.1 Gene:fbxo8 / 100145349 XenbaseID:XB-GENE-964650 Length:316 Species:Xenopus tropicalis


Alignment Length:176 Identity:46/176 - (26%)
Similarity:83/176 - (47%) Gaps:20/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 LSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKI-- 709
            |.:|:..||..|..||:|....|||:.  ...::|.|:.....|:.|.:..|:.::::|..::  
 Frog   136 LDEGSLTFNANPHWGIEYFISRGILDD--SAKEIAKFIFCTRTLNWKNLRLYLDRRRDVLDELVT 198

  Fly   710 LINFVDSFDFTGLRVDQALRLYLETFRLPGE-APLIFLVLEHFSDHWHKQN----QDPFANVDAA 769
            |.||.:.|      :..|||.:......|.| ...:..::..||:.:...|    :|...:.||.
 Frog   199 LHNFSNQF------LPNALRDFFRHIHAPEERGEYLETLITKFSNRFCACNPALARDLGLSPDAV 257

  Fly   770 FRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLR--GLNGGEDF 813
            :.|.|::|:|::|..:.:.|.   .|:..:|.:|.|  ..|..|||
 Frog   258 YVLCYSLILLSIDLASPHVKN---KMSKREFIRNTRRAAQNISEDF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 46/176 (26%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 46/176 (26%)
fbxo8NP_001120293.1 F-box-like 71..109 CDD:372399
Sec7 130..309 CDD:238100 46/176 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.