DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30046 and spon2

DIOPT Version :9

Sequence 1:NP_001286341.1 Gene:CG30046 / 36334 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:XP_031757621.1 Gene:spon2 / 780015 XenbaseID:XB-GENE-945214 Length:345 Species:Xenopus tropicalis


Alignment Length:315 Identity:97/315 - (30%)
Similarity:151/315 - (47%) Gaps:22/315 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VESQPTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWE 238
            ||.....|.:.|..|.|.:.|:|.::|.|.|::...||.:|......::..|||..|||||..|:
 Frog    37 VEYSSCLPLSEDSICTAEEIAKYSIVFTGKWTQASFPKQYPLYRPPAQWSTLLGVTHSSDYHMWK 101

  Fly   239 SGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTIIKARGP-SYPNISSKT-MASVRVD--PI 299
            ..|.||..::::||...:..|.:|  |....:||:::   .|. |..:||..| .||...:  ..
 Frog   102 KLEPASNGVRDFAEKGEAWPLMKE--IETAGEKIQSV---HGIFSTASISGGTGQASTEFEAHSR 161

  Fly   300 HHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDV 364
            |..|||..:|.|||||.|||..|.|| ....|.:...:.|:|:|.|||||.|::|.:...:|..:
 Frog   162 HPFVSFMVRIVPSPDWFVGVDTLNLC-EGKHWKQTATLELHPYDAGTDSGFTFSSPNFATIPQGI 225

  Fly   365 IRRMRSDFPNDPRSPFYDISGTPMKPMA--ILTVKRQRIYE--------RRCADEDSNNDPDVPR 419
            :..:.:..|:.|.:.||......:.|:|  :.|..:.|:..        ....:|.:.:..:.|.
 Frog   226 VTEITASSPSHPANSFYYPRLKSLPPIAKVVFTKVKGRLSSFLDIVSNVTTTGNEIAEHILETPL 290

  Fly   420 ECFTHPWSSWSDCSSKCG-VGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMC 473
            :|....||||..|...|| .|::.|.| |.:.:.|.......|..|::||..|.|
 Frog   291 DCEVSVWSSWGLCRGSCGTAGVKSRTR-YIRLKPANNGTACPALNEDKECDPENC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999 65/191 (34%)
TSP1 425..473 CDD:214559 17/48 (35%)
TSP1 510..561 CDD:214559
spon2XP_031757621.1 Spond_N 57..244 CDD:399462 66/192 (34%)
TSP1_spondin 292..344 CDD:408798 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.