DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30046 and CG42339

DIOPT Version :9

Sequence 1:NP_001286341.1 Gene:CG30046 / 36334 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_572674.3 Gene:CG42339 / 32033 FlyBaseID:FBgn0259241 Length:395 Species:Drosophila melanogaster


Alignment Length:144 Identity:38/144 - (26%)
Similarity:55/144 - (38%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 PWSSWSDC--SSKCGVGMQYRRRVYKQPELARVYNCNEAQ-YEEREC--QGEMCGQNNLMREPEE 484
            |:.|...|  :..|..|......|.|.|..|.:.:.::.. |.:..|  .|:.|         ::
  Fly    19 PFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKLGDCC---------DD 74

  Fly   485 FEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQGVHRME 549
            |:|      ..|.       .:|::..||:||.|..:||.|...|.||.|.....   .|.|...
  Fly    75 FKD------HCGV-------LDCQVGDWGAWSECDRSCGTGMMTRNRQILQAAQN---GGKHCPT 123

  Fly   550 LQETRKCSGRDCLG 563
            ||:.|.|.|..|.|
  Fly   124 LQQKRSCQGYRCHG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999
TSP1 425..473 CDD:214559 12/52 (23%)
TSP1 510..561 CDD:214559 19/50 (38%)
CG42339NP_572674.3 Somatomedin_B <53..79 CDD:279385 6/40 (15%)
TSP1 86..136 CDD:214559 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.