DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30046 and spon2a

DIOPT Version :9

Sequence 1:NP_001286341.1 Gene:CG30046 / 36334 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_571082.1 Gene:spon2a / 30201 ZFINID:ZDB-GENE-990415-160 Length:334 Species:Danio rerio


Alignment Length:301 Identity:95/301 - (31%)
Similarity:141/301 - (46%) Gaps:23/301 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 CCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAE 252
            |.|...|.|.::|.|.||....||.:|......::.:|:...|:..||.|:.|..||..||.:||
Zfish    38 CSARGPASYIVVFTGHWSPQTFPKQYPLFRPPAQWSKLMVVTHNEQYRLWQEGAPASDGMKSFAE 102

  Fly   253 HCSSRLLEREFSINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIV 317
            ...:..|.::.....:.:.:.::.:..|  .|:....:...|.:.|...:||...|:.|||||.|
Zfish   103 QGLTVDLVKDAKEARKRRSVGSMYRTAG--IPSGIGHSSTEVLLTPRSPLVSLIVKLIPSPDWFV 165

  Fly   318 GVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYD 382
            ||.||.|| ....|.:|...:|:|:|.|||||.|::|.:.|..||:.|..:.|..||.|.:.||.
Zfish   166 GVDGLNLC-EGGKWKQEVTFDLHPFDAGTDSGFTFSSPNFPTTPPENITMITSQKPNHPANSFYY 229

  Fly   383 ISGTPMKPMAILTVKRQRIYERRCADEDSNND-PD---------VPRECFTHPWSSWSDCSSKCG 437
            .....:.|:|.:.||||.....|..:..||:. ||         .|.:|....||||..|...|.
Zfish   230 PRLNELPPLATIWVKRQSRLPVRQQNRLSNHILPDASKPHRFSETPLDCEVSMWSSWGLCFGPCA 294

  Fly   438 -VGMQYRRRVYKQPELARVYN----CNEAQYEERECQGEMC 473
             .|:::|.|..    |.:..|    |.|.: |:.||....|
Zfish   295 RGGLRHRTRYI----LLKPANSGSPCPELE-EQEECTPHNC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999 62/187 (33%)
TSP1 425..473 CDD:214559 16/52 (31%)
TSP1 510..561 CDD:214559
spon2aNP_571082.1 Spond_N 44..230 CDD:283999 63/188 (34%)
TSP1 283..330 CDD:214559 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.