DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30046 and SPON1

DIOPT Version :9

Sequence 1:NP_001286341.1 Gene:CG30046 / 36334 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_006099.2 Gene:SPON1 / 10418 HGNCID:11252 Length:807 Species:Homo sapiens


Alignment Length:709 Identity:207/709 - (29%)
Similarity:308/709 - (43%) Gaps:162/709 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PLVELLLLGSLVIGRV--SSLICTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNA- 69
            ||...|......:.:|  |...|:|.....|:.:....| |.:.|.|:|:.|..|..|.|:|:| 
Human    22 PLAAALAFSDETLDKVPKSEGYCSRILRAQGTRREGYTE-FSLRVEGDPDFYKPGTSYRVTLSAA 85

  Fly    70 ----FNGHRYISFIMALENENGDFSYNDDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLT 130
                |.|   .:.|...||..|| ...|..|.|::.|..||:|..||...|..:....:|.:.:.
Human    86 PPSYFRG---FTLIALRENREGD-KEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVF 146

  Fly   131 WVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEE--VTDDVESQPTAPAAVDVPCCACDE 193
            |:|| ..|:|||:::|::.|.|.::..|:|.|||::||:  ..|.|..:|.      :.||||..
Human   147 WIAP-PAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPI------LDCCACGT 204

  Fly   194 ARYELIFEGVWSRNLHPKDFPTRG--WETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSS 256
            |:|.|.|.|.||...||||:|.|.  |..    ::|.:||.:|..||.|..||..:|:.||..|.
Human   205 AKYRLTFYGNWSEKTHPKDYPRRANHWSA----IIGGSHSKNYVLWEYGGYASEGVKQVAELGSP 265

  Fly   257 RLLEREFSINFRDQKIRTIIKARG--PSYP--NISSKTMASVRVDPIHHMVSFASKIEPSPDWIV 317
            ..:|.|  |..:..::.|:|||:.  |::.  |:.:...|...||...|::||.:.:.|||||.|
Human   266 VKMEEE--IRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNV 328

  Fly   318 GVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYD 382
            |::..:||.:.|.|:::.|.:|.|||.|||||.||.|.::|.:|.:.||.:.|  .:.|:|||||
Human   329 GLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTS--LDHPQSPFYD 391

  Fly   383 ISGTPMKPMAILTVKRQRIYERRC--------------ADEDSNNDPDVPRECFTHPWSSWSDCS 433
            ..|..:..:|.:.::|......:|              |.|:.:.| |.|..|....||.||.||
Human   392 PEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDED-DTPETCIYSNWSPWSACS 455

  Fly   434 S-----------------------------------------------------------KCGVG 439
            |                                                           .||:|
Human   456 SSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMG 520

  Fly   440 MQYRRRVYKQ-PELARVYNCNEAQYEERECQ-GEMCGQNN-LMREPEEFED--------LEPDPR 493
            |:.|.|..|| ||...|  |.....|..:|. .|.|..:: ||.|..|:::        ::...|
Human   521 MRSRERYVKQFPEDGSV--CTLPTEETEKCTVNEECSPSSCLMTEWGEWDECSATCGMGMKKRHR 583

  Fly   494 RIGYQP-------SQQRRAE-----------CELSSWGSWSPCSVTCGDGYEMRQR--------- 531
            .|...|       ::..:||           |.||.|..||.||||||.|...|||         
Human   584 MIKMNPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELG 648

  Fly   532 ----------QYLNPQAEFDCQGVHRMELQETRKCSGRDCLGSLPGSYSTDMDSPYGGA 580
                      :.:.|:...||:.....:..|..|..|:   |.:..:....|:..:|||
Human   649 DCNEDLEQVEKCMLPECPIDCELTEWSQWSECNKSCGK---GHVIRTRMIQMEPQFGGA 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 47/143 (33%)
Spond_N 194..382 CDD:283999 75/193 (39%)
TSP1 425..473 CDD:214559 22/108 (20%)
TSP1 510..561 CDD:214559 20/69 (29%)
SPON1NP_006099.2 Reeler 43..182 CDD:260081 47/144 (33%)
Spond_N 205..392 CDD:310815 76/194 (39%)
TSP_1 446..494 CDD:306574 7/47 (15%)
TSP_1 505..554 CDD:306574 15/50 (30%)
TSP_1 562..610 CDD:306574 7/47 (15%)
TSP_1 618..665 CDD:306574 15/46 (33%)
TSP_1 672..720 CDD:306574 8/36 (22%)
TSP_1 758..807 CDD:306574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141173
Domainoid 1 1.000 184 1.000 Domainoid score I3413
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 394 1.000 Inparanoid score I1976
Isobase 1 0.950 - 0 Normalized mean entropy S5564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 1 1.000 - - FOG0003147
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104958
Panther 1 1.100 - - O PTHR11311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2543
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.