DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30046 and SPON2

DIOPT Version :9

Sequence 1:NP_001286341.1 Gene:CG30046 / 36334 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_001121797.2 Gene:SPON2 / 10417 HGNCID:11253 Length:331 Species:Homo sapiens


Alignment Length:328 Identity:104/328 - (31%)
Similarity:157/328 - (47%) Gaps:23/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LTKRICEEV--TDDVESQPTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCE 224
            |.|.:|..:  |.....||....::   |.|...|:|.:.|.|.||:...||.:|......::..
Human    10 LGKALCALLLATLGAAGQPLGGESI---CSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSS 71

  Fly   225 LLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREF-SINFRDQKIRTIIKARGPSYPNISS 288
            ||||||||||..|...:..|..::::||...:..|.:|. :.....|.:..:..|  |:.|:.:.
Human    72 LLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSA--PAVPSGTG 134

  Fly   289 KTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYT 353
            :|.|.:.|...|.:|||..:|.|||||.|||..|:|| ....|.|:..::|||:|.|||||.|::
Human   135 QTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFS 198

  Fly   354 SSDQPQVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQR------------IYERRC 406
            |.:...:|.|.:..:.|..|:.|.:.||......:.|:|.:|:.|.|            :..|..
Human   199 SPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDN 263

  Fly   407 ADEDSNNDPDVPRECFTHPWSSWSDCSSKCG-VGMQYRRRVYKQPELARVYNCNEAQYEERECQG 470
            ...||.:.|:.|.:|....||||..|...|| :|.:.|.|..:.........|.|.: ||.||..
Human   264 EIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELE-EEAECVP 327

  Fly   471 EMC 473
            :.|
Human   328 DNC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 2/4 (50%)
Spond_N 194..382 CDD:283999 67/188 (36%)
TSP1 425..473 CDD:214559 16/48 (33%)
TSP1 510..561 CDD:214559
SPON2NP_001121797.2 Spond_N 41..228 CDD:399462 68/189 (36%)
TSP1_spondin 278..330 CDD:408798 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.