DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17739 and spon2a

DIOPT Version :9

Sequence 1:NP_610757.1 Gene:CG17739 / 36333 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_571082.1 Gene:spon2a / 30201 ZFINID:ZDB-GENE-990415-160 Length:334 Species:Danio rerio


Alignment Length:297 Identity:94/297 - (31%)
Similarity:144/297 - (48%) Gaps:20/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CCACDEAKYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAE 244
            |.|...|.|.:.|.|.||..|.||.:|......::|.::..:|...||.||.|..||:|::..||
Zfish    38 CSARGPASYIVVFTGHWSPQTFPKQYPLFRPPAQWSKLMVVTHNEQYRLWQEGAPASDGMKSFAE 102

  Fly   245 HGSTRTLESELKD--QSEHIRTIIKARGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIV 307
            .|.|..|..:.|:  :...:.::.:..||  |:..|.:.....:.....|:||:..:.|||||.|
Zfish   103 QGLTVDLVKDAKEARKRRSVGSMYRTAGI--PSGIGHSSTEVLLTPRSPLVSLIVKLIPSPDWFV 165

  Fly   308 GVSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYD 372
            ||.||.|| ....|.:....:|:|:|||||||.::.|.:.|..||:.:..|.|..||.|.:.||.
Zfish   166 GVDGLNLC-EGGKWKQEVTFDLHPFDAGTDSGFTFSSPNFPTTPPENITMITSQKPNHPANSFYY 229

  Fly   373 PTGAQMKPLATLHINRRR---LYEKNCESS----DS------EQVPPECATNSWSRWDECTTKCG 424
            |...::.||||:.:.|:.   :.::|..|:    |:      .:.|.:|..:.||.|..|...|.
Zfish   230 PRLNELPPLATIWVKRQSRLPVRQQNRLSNHILPDASKPHRFSETPLDCEVSMWSSWGLCFGPCA 294

  Fly   425 -PGKQYRIREFKNPALASRHRCNNALREEKNCVGHKC 460
             .|.::|.|........|...|.. |.|::.|..|.|
Zfish   295 RGGLRHRTRYILLKPANSGSPCPE-LEEQEECTPHNC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081
Spond_N 186..373 CDD:283999 66/188 (35%)
TSP1 412..460 CDD:214559 14/48 (29%)
TSP1 490..541 CDD:214559
KU 661..715 CDD:294074
TSP_1 815..862 CDD:278517
spon2aNP_571082.1 Spond_N 44..230 CDD:283999 66/188 (35%)
TSP1 283..330 CDD:214559 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.