DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17739 and Spon2

DIOPT Version :9

Sequence 1:NP_610757.1 Gene:CG17739 / 36333 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_612542.1 Gene:Spon2 / 171569 RGDID:708584 Length:330 Species:Rattus norvegicus


Alignment Length:304 Identity:104/304 - (34%)
Similarity:145/304 - (47%) Gaps:31/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CCACDEAKYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAE 244
            |.|...|:|.:||.||||:...||.:|......::|.::||:|:.||..|:..|..|.|||:.||
  Rat    34 CTARPLARYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAE 98

  Fly   245 HGSTRTLESELKDQSEHIRTIIKA-RGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVG 308
            .|....|..|::...|.::::... ...|.|:.||:|.|...|...|.|:|.|..:.|||||.||
  Rat    99 RGEAWALMKEIEAAGEKLQSVHAVFSAPAVPSGTGQTSAELEVHPRHSLVSFVVRIVPSPDWFVG 163

  Fly   309 VSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDP 373
            :..|:|| ....|.|..|.:|||.|||||||.::.|.:...:|.|.|..|.::.|:.|.:.||.|
  Rat   164 IDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYP 227

  Fly   374 TGAQMKPLATLHINRRR------------LYEKNCESSDSEQVPP---ECATNSWSRWDECTTKC 423
            ....:.|:|.:...|.|            |..:..|..||..||.   :|..:.||.|..|...|
  Rat   228 RLKSLPPIAKVTFVRLRQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSLWSSWGLCGGPC 292

  Fly   424 GP-GKQYRIREFK-NPALASRHRCNNA-----LREEKNCVGHKC 460
            |. |.:.|.|..: .||       ||.     |.||..|....|
  Rat   293 GKLGAKSRTRYVRVQPA-------NNGTPCPELEEEAECAPDNC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081
Spond_N 186..373 CDD:283999 72/187 (39%)
TSP1 412..460 CDD:214559 17/54 (31%)
TSP1 490..541 CDD:214559
KU 661..715 CDD:294074
TSP_1 815..862 CDD:278517
Spon2NP_612542.1 Spond_N 40..227 CDD:283999 72/187 (39%)
TSP1 279..329 CDD:214559 17/56 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.