DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment salto and FDM1

DIOPT Version :9

Sequence 1:NP_610756.2 Gene:salto / 36332 FlyBaseID:FBgn0061197 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_173043.1 Gene:FDM1 / 838161 AraportID:AT1G15910 Length:634 Species:Arabidopsis thaliana


Alignment Length:448 Identity:92/448 - (20%)
Similarity:184/448 - (41%) Gaps:101/448 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 ASEKREETQKKLSNLVEEKMNLIVEEIEQLCGACSK-----QESPNK---SLYREMSELRSQKQA 328
            :.|.:..|...:|....:..|.::||:..:....::     |.|.|:   ||.|.:.|.::..||
plant   233 SKEGQLRTVSDISQKNVQDRNTVLEELSDMIAMTNEDLNKVQYSYNRTAMSLQRVLDEKKNLHQA 297

  Fly   329 MEVRYFDAQKEHTEQMNQLRIELDAKLKQELASRDQIIVELRKSLRRSEDMLS--EQSIRLAENN 391
            .        .:.|::|.|:.:.   .:::.|..::::..||.:.:|..|....  |:...|.|.:
plant   298 F--------ADETKKMQQMSLR---HIQKILYDKEKLSNELDRKMRDLESRAKQLEKHEALTELD 351

  Fly   392 SKLLTEDSTIEVLRSEVAKLKTVKEQMVKRLEEADKGLERARNSVDKNLKHIDYLEGELKEAREL 456
            .:.|.||             |...:.|.|.|:.|.:..::|..||   |:.::..:.:.::|...
plant   352 RQKLDED-------------KRKSDAMNKSLQLASREQKKADESV---LRLVEEHQRQKEDALNK 400

  Fly   457 IVHLEQRPDAMDAGVKEKDLIIADLKLQLQSLEQHKKVMNKQVANTIKQHADFEELGGNYKEALQ 521
            |:.||::.|....           |::::|.|:...:||              :.||.:..||:|
plant   401 ILLLEKQLDTKQT-----------LEMEIQELKGKLQVM--------------KHLGDDDDEAVQ 440

  Fly   522 -QISDLRETLSVTNAKLE----MQSKL---EVQLRKEVSKMREQMVID-QKLLNARSELIATLQK 577
             ::.::.:.|....|:||    |.|.|   |.|...|:...|::::.. ..||.|.:: |...:.
plant   441 KKMKEMNDELDDKKAELEGLESMNSVLMTKERQSNDEIQAARKKLIAGLTGLLGAETD-IGVKRM 504

  Fly   578 NEEDSRTKLD--QMYYQVS----EKETLINQVNNKLSSKEEEFYNLYGTLTHKQREVRRQEHIIK 636
            .|.|.:..||  ::.|..:    |..||.:.....|.:...:.:...||....:..|...:..:|
plant   505 GELDEKPFLDVCKLRYSANEAAVEAATLCSTWQENLKNPSWQPFKHEGTGDGAEEVVDEDDEQLK 569

  Fly   637 LLKEQ------NS-RVSLLRANQ----------------DERNATMEEEIKHLKNALR 671
            .||.:      |: :.:|:..|:                :.|.||::|.|..:.|.::
plant   570 KLKREWGKEVHNAVKTALVEMNEYNASGRYTTPELWNFKEGRKATLKEVITFISNDIK 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saltoNP_610756.2 DUF1640 <313..422 CDD:285090 23/113 (20%)
BAR <518..670 CDD:299863 42/189 (22%)
YjbI <713..803 CDD:224276
FDM1NP_173043.1 zf-XS 41..83 CDD:251981
XS 117..224 CDD:397506
Smc 211..>485 CDD:224117 64/303 (21%)
XH 502..632 CDD:397507 24/126 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.