DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment salto and IDN2

DIOPT Version :9

Sequence 1:NP_610756.2 Gene:salto / 36332 FlyBaseID:FBgn0061197 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_001327083.1 Gene:IDN2 / 824027 AraportID:AT3G48670 Length:647 Species:Arabidopsis thaliana


Alignment Length:368 Identity:86/368 - (23%)
Similarity:161/368 - (43%) Gaps:55/368 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 EASEKREETQKKLSNLVEEKMNLIVEEIEQLCGACSKQESPNKSLYREMSELRSQKQAMEVRYFD 335
            |.:.|:|...:.|..|||||.. .::|||:||..  |.|..|     ::.|.:.:.|....|..:
plant   259 EEARKQELLVQNLRQLVEEKKK-DMKEIEELCSV--KSEELN-----QLMEEKEKNQQKHYRELN 315

  Fly   336 AQKEHTEQMNQLRIELDAKLKQELAS-RDQIIVELRKSLRRSEDMLSEQSIRLAENNSKLLTEDS 399
            |.:|.|....|..::...|||:.|.| |.::.::..:..:|.....:|: ::|:|:..:..:::|
plant   316 AIQERTMSHIQKIVDDHEKLKRLLESERKKLEIKCNELAKREVHNGTER-MKLSEDLEQNASKNS 379

  Fly   400 TIEVLR-------SEVAKLKTVKEQMVKRLEEADKGLERARNSVDKNLKHIDYLEGELKEARELI 457
            ::|:..       .||.||...:.:..:.|.|....|||.|:........::.|:|:|    .::
plant   380 SLELAAMEQQKADEEVKKLAEDQRRQKEELHEKIIRLERQRDQKQAIELEVEQLKGQL----NVM 440

  Fly   458 VHLEQRPDAMDAGVKEKDLIIADL---KLQLQSLEQHKKVMNKQVANTIKQHADFEELGGNYKEA 519
            .|:....||  ..|||.|:|..||   :.||..|::..:.:      .:::....:||...:||.
plant   441 KHMASDGDA--EVVKEVDIIFKDLGEKEAQLADLDKFNQTL------ILRERRTNDELQEAHKEL 497

  Fly   520 LQQISDLRETLSV-----------TNAKLEMQSKLEVQLRK-EVSKMREQMVIDQ--------KL 564
            :..:.:....:.|           .:|..:...:.:|:.|. ||.::.|..:.|.        ||
plant   498 VNIMKEWNTNIGVKRMGELVTKPFVDAMQQKYCQQDVEDRAVEVLQLWEHYLKDSDWHPFKRVKL 562

  Fly   565 LNARSELIATLQKNEEDSRTKL---DQMYYQVSEKETLINQVN 604
            .|...|:.....::|:....|.   |..|..|::....||:.|
plant   563 ENEDREVEVIDDRDEKLRELKADLGDGPYNAVTKALLEINEYN 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saltoNP_610756.2 DUF1640 <313..422 CDD:285090 23/116 (20%)
BAR <518..670 CDD:299863 21/110 (19%)
YjbI <713..803 CDD:224276
IDN2NP_001327083.1 zf-XS 48..91 CDD:251981
XS 124..235 CDD:397506
Smc <245..>477 CDD:224117 62/232 (27%)
XH 511..643 CDD:397507 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.