DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment salto and CG42326

DIOPT Version :9

Sequence 1:NP_610756.2 Gene:salto / 36332 FlyBaseID:FBgn0061197 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_001286200.1 Gene:CG42326 / 35838 FlyBaseID:FBgn0259226 Length:1376 Species:Drosophila melanogaster


Alignment Length:126 Identity:30/126 - (23%)
Similarity:42/126 - (33%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SDKATWSRTSSCGGVFS-TPPTQNGDGSP-------------NKGRLSHIPNRRGASRSSIHSRK 80
            |...:.|.:.|..|.|. |||:..|...|             ...|...:|:..|...|:....:
  Fly   660 SSHGSGSSSGSSSGYFGHTPPSSYGGDHPYVDRHDSPHYRPGRPDRWETLPSSSGYDSSAYRPPR 724

  Fly    81 TSLERVTSSTKARP------CVSTYSLPNRRVEPEHKVVEPDRKTDIDELNPPKRNVVPIK 135
            ...:|:   .|.||      ..|.|..|:|   |.|..::.|   ......||..|..|.|
  Fly   725 PETDRI---DKYRPPYRPGSDYSPYRPPSR---PSHNYLDRD---GAGPPGPPGSNKKPNK 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saltoNP_610756.2 DUF1640 <313..422 CDD:285090
BAR <518..670 CDD:299863
YjbI <713..803 CDD:224276
CG42326NP_001286200.1 PAN_AP 44..>104 CDD:214680
PAN_AP_HGF 468..560 CDD:238532
PAN_AP_HGF 870..953 CDD:238532
PAN_AP_HGF 984..1070 CDD:238532
PAN_APPLE 1100..1168 CDD:294081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CN3F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.