DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8850 and CG31904

DIOPT Version :9

Sequence 1:NP_725122.2 Gene:CG8850 / 36331 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:162 Identity:49/162 - (30%)
Similarity:72/162 - (44%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RDQWSRGVEFLF-SCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQF 120
            |.:|::..:|.| ||......|.......|..|..|...|:|.|::.:|....|::.::..:|||
  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQF 148

  Fly   121 SSRGCIRAFDMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KS 184
            ||.|.|.||.:|||.:||.|..:.......|||:....:.:.|.|.|...|:||..|...|. :.
  Fly   149 SSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNTQE 213

  Fly   185 C-----------VATGATAANDSSIVQGVSSA 205
            |           ||...|.|    :..||.|:
  Fly   214 CSLHENYDVDFAVAVIFTLA----LAMGVQSS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 48/161 (30%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 39/123 (32%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.