DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8850 and Y43D4A.1

DIOPT Version :9

Sequence 1:NP_725122.2 Gene:CG8850 / 36331 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_502983.2 Gene:Y43D4A.1 / 189850 WormBaseID:WBGene00012787 Length:91 Species:Caenorhabditis elegans


Alignment Length:66 Identity:29/66 - (43%)
Similarity:37/66 - (56%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAF 95
            |:|.|....|....|.   ||::...|..|...:|||.|.:.::|||||:||||..|..|||.||
 Worm    28 IATTIVRDSGSSKEIE---ESQADPCRGAWGNQIEFLLSTLGMAVGLGNIWRFPTRAYNNGGSAF 89

  Fly    96 L 96
            |
 Worm    90 L 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 21/39 (54%)
Y43D4A.1NP_502983.2 SLC5-6-like_sbd 52..>90 CDD:294310 19/37 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.