powered by:
Protein Alignment CG8850 and Y43D4A.1
DIOPT Version :9
Sequence 1: | NP_725122.2 |
Gene: | CG8850 / 36331 |
FlyBaseID: | FBgn0033708 |
Length: | 629 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502983.2 |
Gene: | Y43D4A.1 / 189850 |
WormBaseID: | WBGene00012787 |
Length: | 91 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 29/66 - (43%) |
Similarity: | 37/66 - (56%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 ISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAF 95
|:|.|....|....|. ||::...|..|...:|||.|.:.::|||||:||||..|..|||.||
Worm 28 IATTIVRDSGSSKEIE---ESQADPCRGAWGNQIEFLLSTLGMAVGLGNIWRFPTRAYNNGGSAF 89
Fly 96 L 96
|
Worm 90 L 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0733 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D250396at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.