DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42700 and H10D18.5

DIOPT Version :9

Sequence 1:NP_001286339.1 Gene:CG42700 / 36330 FlyBaseID:FBgn0261611 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001317824.1 Gene:H10D18.5 / 186716 WormBaseID:WBGene00019180 Length:393 Species:Caenorhabditis elegans


Alignment Length:217 Identity:55/217 - (25%)
Similarity:95/217 - (43%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 VQQANTAVGGMLLANMEKSSEFPFISYYLINTLQTDPSSFYAGLRVSSLSKFEPKALKYTAAHTL 379
            :|:.......:||..::....||::.:                      ::|  :.:.||  |.:
 Worm   120 IQEKKDFAEAVLLKCIDNKPLFPYMHF----------------------AQF--RNVDYT--HRV 158

  Fly   380 DLYSEVAAICRPP------------LVLPSNEVGSFKKSQTAATGYIISVFKVFEGDDGER--FE 430
            ...|::|..|.|.            .:..:..||.::......:|||:..||:.| |.|::  .|
 Worm   159 KQISDLARECSPTHGSLYGCYDEVYSIQKTASVGEYRLPAHRHSGYIVIGFKLLE-DAGKQGNLE 222

  Fly   431 KNWLYWTGARMLYRYLPRAAGLRRIAL------HKSTSQKGDKMYLLVCECAELL--KDISLAAF 487
            |.||.|:|||.:|::.||:..||||:|      ||:...:....|:|:||...:|  .:...|..
 Worm   223 KTWLQWSGAREIYKHSPRSWNLRRISLMRCPTHHKNGVAQRPFAYILMCEYGSILHPSNTIQALD 287

  Fly   488 LIPALRARLCGYTGLYRPIQAF 509
            :...||.|.||:..||:...|:
 Worm   288 ICERLRVRNCGHIALYQVHSAY 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008567
OrthoInspector 1 1.000 - - oto18446
orthoMCL 1 0.900 - - OOG6_116708
Panther 1 1.100 - - LDO PTHR22198
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.