DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42700 and C01C4.2

DIOPT Version :9

Sequence 1:NP_001286339.1 Gene:CG42700 / 36330 FlyBaseID:FBgn0261611 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001359815.1 Gene:C01C4.2 / 182065 WormBaseID:WBGene00015292 Length:453 Species:Caenorhabditis elegans


Alignment Length:194 Identity:45/194 - (23%)
Similarity:74/194 - (38%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 QTDPSSFYAGLRVS--SLSKFEPKALK-----YTAAH-------------------------TLD 380
            |.|..:|...||:.  :|.:...|.||     |...|                         |..
 Worm    31 QCDSINFPFSLRLDNPTLERIAVKKLKCIERGYAYPHIDIVFARGETSLLTNGLITSEKDQKTCG 95

  Fly   381 LYSEVAAICRPPL---VLPSNEVGSFKKSQTAATGYIISVFKVFEGDDGERFEKNWLYWTGARML 442
            .|..|..|.|...   :||..|      ::|...||:|..:...|.....:|..:|..|:|||||
 Worm    96 FYKSVQTISRNSTELQLLPDFE------TKTNLNGYVIFAYNTMEHMHTPKFTTSWKTWSGARML 154

  Fly   443 YRYLPRAAGLRRIALHKSTSQKGDKMYLLVCECAELLKDISLAAFLIPALRARLCGYTGLYRPI 506
            ...:|....:.:::..|..|......|:|:.:...::.:.:.|..::..::.:||.|.|.||.|
 Worm   155 STRMPLPHIVTKMSFFKKVSGHLTFEYILIAKVKNMMVNAAPALNVLHYMKPKLCAYVGAYRKI 218



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29BUM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.