Sequence 1: | NP_001286339.1 | Gene: | CG42700 / 36330 | FlyBaseID: | FBgn0261611 | Length: | 509 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359815.1 | Gene: | C01C4.2 / 182065 | WormBaseID: | WBGene00015292 | Length: | 453 | Species: | Caenorhabditis elegans |
Alignment Length: | 194 | Identity: | 45/194 - (23%) |
---|---|---|---|
Similarity: | 74/194 - (38%) | Gaps: | 41/194 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 348 QTDPSSFYAGLRVS--SLSKFEPKALK-----YTAAH-------------------------TLD 380
Fly 381 LYSEVAAICRPPL---VLPSNEVGSFKKSQTAATGYIISVFKVFEGDDGERFEKNWLYWTGARML 442
Fly 443 YRYLPRAAGLRRIALHKSTSQKGDKMYLLVCECAELLKDISLAAFLIPALRARLCGYTGLYRPI 506 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_29BUM | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.860 |