DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and MYL10

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_612412.2 Gene:MYL10 / 93408 HGNCID:29825 Length:226 Species:Homo sapiens


Alignment Length:182 Identity:54/182 - (29%)
Similarity:81/182 - (44%) Gaps:42/182 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKE----------------------------------AFSLFDKDGDGTITTK 31
            |.||   .||.||||                                  ||::.|::.||.|..:
Human    46 MFDQ---SQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKE 107

  Fly    32 ELGTVMRSLGQ-NPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDK 95
            :|.....:||: |....||:.|:.|..    |.|:|..||||...|:|.||.||.|..||:|||.
Human   108 DLRDTFAALGRINVKNEELEAMVKEAP----GPINFTVFLTMFGEKLKGTDPEETILHAFKVFDT 168

  Fly    96 DGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMT 147
            :|.||:.|..::..:....::.::|||.:|......|..|.::|.....::|
Human   169 EGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVIT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 54/182 (30%)
MYL10NP_612412.2 FRQ1 40..223 CDD:227455 54/182 (30%)
EF-hand motif 89..118 CDD:320054 8/28 (29%)
EF-hand motif 149..187 CDD:320054 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.