DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and MLC1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_011409.1 Gene:MLC1 / 852772 SGDID:S000003074 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:51/139 - (36%)
Similarity:87/139 - (62%) Gaps:12/139 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN----GTIDFPEFLTMMA 74
            |:.|:||||.|.|.|....||..:|::|.|||...:||:||   ||.:    .::...:...::.
Yeast     8 KDIFTLFDKKGQGAIAKDSLGDYLRAIGYNPTNQLVQDIIN---ADSSLRDASSLTLDQITGLIE 69

  Fly    75 RKMKDTDS-----EEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGD 134
            ...|:.|:     .|:..:||:||||:..|.:|..:||:::|.|||||||.||||:::..::|.:
Yeast    70 VNEKELDATTKAKTEDFVKAFQVFDKESTGKVSVGDLRYMLTGLGEKLTDAEVDELLKGVEVDSN 134

  Fly   135 GQVNYEEFV 143
            |:::|::|:
Yeast   135 GEIDYKKFI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 51/139 (37%)
MLC1NP_011409.1 FRQ1 1..149 CDD:227455 51/139 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.