DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CMD1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_009667.1 Gene:CMD1 / 852406 SGDID:S000000313 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:88/147 - (59%)
Similarity:123/147 - (83%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |:..|||||||||||||:|||||.:|:|::.||.|||||||.:|:|||:.|::||:|.|||..|:
Yeast     1 MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIE 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |.|||.:|:|::|..|||:|:.|||:||||:|:|.||||||:||:|::||||||.|||:|:||..
Yeast    66 FSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDMLREVS 130

  Fly   131 IDGDGQVNYEEFVTMMT 147
             ||.|::|.::|..:::
Yeast   131 -DGSGEINIQQFAALLS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 88/147 (60%)
CMD1NP_009667.1 PTZ00184 1..145 CDD:185504 88/144 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345836
Domainoid 1 1.000 85 1.000 Domainoid score I1901
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I904
Isobase 1 0.950 - 0 Normalized mean entropy S63
OMA 1 1.010 - - QHG53747
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm46902
orthoMCL 1 0.900 - - OOG6_100851
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R162
SonicParanoid 1 1.000 - - X199
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.