DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CAM4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001185330.1 Gene:CAM4 / 842959 AraportID:AT1G66410 Length:159 Species:Arabidopsis thaliana


Alignment Length:159 Identity:133/159 - (83%)
Similarity:144/159 - (90%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGD----------GTITTKELGTVMRSLGQNPTEAELQDMINE 55
            ||||||:|||:||||||||||||||          |.||||||||||||||||||||||||||||
plant     1 MADQLTDEQISEFKEAFSLFDKDGDDSISDSGDSCGCITTKELGTVMRSLGQNPTEAELQDMINE 65

  Fly    56 VDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE 120
            |||||||||||||||.:||:||||||||||::|||||||||.|||||||||||||||||||||||
plant    66 VDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE 130

  Fly   121 EVDEMIREADIDGDGQVNYEEFVTMMTSK 149
            ||:|||||||:|||||:||||||.:|.:|
plant   131 EVEEMIREADVDGDGQINYEEFVKIMMAK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 132/157 (84%)
CAM4NP_001185330.1 PTZ00184 1..159 CDD:185504 132/157 (84%)
EFh <36..84 CDD:238008 44/47 (94%)
EFh 95..157 CDD:238008 53/61 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1856
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I893
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm3085
orthoMCL 1 0.900 - - OOG6_100851
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.