DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and EFCAB2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_011542602.1 Gene:EFCAB2 / 84288 HGNCID:28166 Length:185 Species:Homo sapiens


Alignment Length:147 Identity:57/147 - (38%)
Similarity:85/147 - (57%) Gaps:11/147 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAEF----KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV-DADGNGTIDFPEF 69
            :|||    ||||.:||.:.:.|:..:|:||::||||..|||.||.|:|.|| :.:..|.|.|.:|
Human    35 VAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKF 99

  Fly    70 LTMMA-----RKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 129
            |.:|.     ||.:.. .|:.:..||.|.|....||::..||...||..||..:.||::||:..|
Human   100 LPVMTEILLERKYRPI-PEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAA 163

  Fly   130 DIDGDGQVNYEEFVTMM 146
            .......:||::::|||
Human   164 IDPESNSINYKDYITMM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 57/147 (39%)
EFCAB2XP_011542602.1 PTZ00184 35..181 CDD:185504 57/147 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.