DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AT1G21550

DIOPT Version :10

Sequence 1:NP_523710.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_564143.1 Gene:AT1G21550 / 838756 AraportID:AT1G21550 Length:155 Species:Arabidopsis thaliana


Alignment Length:151 Identity:51/151 - (33%)
Similarity:73/151 - (48%) Gaps:24/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLG---QNPTEAELQDMINEVDADGNGTIDFPEFLTMM 73
            :.:..|...||:.||.:|..||..::..||   ..|.|.||        ..|..::|..|||...
plant    10 DLRRMFKTLDKNQDGLVTLDELLWILDKLGWAEHTPDELEL--------IVGKQSLDLDEFLRFY 66

  Fly    74 ARKMKDT-----------DSEEEIREAFRVFDKDGNGFISAAELRHVMTNLG--EKLTDEEVDEM 125
            ...:.|:           |::|.|..||.|||.:|:|:|||.|||.|:..||  |:....:...|
plant    67 YDAVLDSKGSKKNIDVVADNDEAIARAFNVFDVNGDGYISAEELRDVLERLGFEEEAKAWDCGRM 131

  Fly   126 IREADIDGDGQVNYEEFVTMM 146
            ||..|.:.||.|::|||..|:
plant   132 IRVHDKNLDGFVDFEEFKNMI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_523710.1 PTZ00184 1..149 CDD:185504 51/151 (34%)
AT1G21550NP_564143.1 FRQ1 6..152 CDD:444056 50/149 (34%)

Return to query results.
Submit another query.