DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AT1G18210

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_173259.1 Gene:AT1G18210 / 838401 AraportID:AT1G18210 Length:170 Species:Arabidopsis thaliana


Alignment Length:137 Identity:62/137 - (45%)
Similarity:85/137 - (62%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76
            |.|:.|..||.:|||.|:..|||.|.:::|.:.||.||..::.|||.|.:|.|:..||.|:    
plant    23 ELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTDRDGYINLDEFSTL---- 83

  Fly    77 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 141
            .:.:.|..|||:||.::|:|.||.|||:||..|:..||...:.|:...||...|.||||.||:||
plant    84 CRSSSSAAEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDADGDGNVNFEE 148

  Fly   142 FVTMMTS 148
            |..||||
plant   149 FQKMMTS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 62/137 (45%)
AT1G18210NP_173259.1 PTZ00184 22..154 CDD:185504 59/134 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.