DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AT1G12310

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_172695.1 Gene:AT1G12310 / 837785 AraportID:AT1G12310 Length:148 Species:Arabidopsis thaliana


Alignment Length:147 Identity:67/147 - (45%)
Similarity:102/147 - (69%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67
            |.|:::|::..||||.|||.||||.|...|||.:|||||.|||:|:|:.:|  ...:.:...||.
plant     4 DGLSDDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSII--ASENLSSPFDFN 66

  Fly    68 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID 132
            .||.:||:.:|....:.::|:||:|.||:|.||::.|:|||::|::||||...|.||.|:|.|:.
plant    67 RFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLEPNEFDEWIKEVDVG 131

  Fly   133 GDGQVNYEEFVTMMTSK 149
            .||::.||:|:..|.:|
plant   132 SDGKIRYEDFIARMVAK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 66/145 (46%)
AT1G12310NP_172695.1 PTZ00184 4..148 CDD:185504 66/145 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.