DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CALN1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_113656.2 Gene:CALN1 / 83698 HGNCID:13248 Length:261 Species:Homo sapiens


Alignment Length:147 Identity:47/147 - (31%)
Similarity:85/147 - (57%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69
            ::.|::.|.:|||.:.|:||:|.|:.:|||..|||||..|:|.||..::..:|.||:|.:||.||
Human    75 ISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEF 139

  Fly    70 LTMMARKMKDTDSEE-----EIREAFRVFDKDGNGFISAAELRHVMTN-LGEKLTDEEVDEMI-- 126
            :|::..|:..::..:     .|...|..||...   |:..||:|::.: ..:.||.::::.:|  
Human   140 MTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQR---ITLEELKHILYHAFRDHLTMKDIENIIIN 201

  Fly   127 -REA--DIDGDGQVNYE 140
             .|:  :..|:.|..:|
Human   202 EEESLNETSGNCQTEFE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 47/147 (32%)
CALN1NP_113656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
PTZ00184 74..>184 CDD:185504 40/111 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.