DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CPK28

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_201422.1 Gene:CPK28 / 836753 AraportID:AT5G66210 Length:523 Species:Arabidopsis thaliana


Alignment Length:148 Identity:43/148 - (29%)
Similarity:83/148 - (56%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDADGNGTI 64
            :|..|.|.:|::.::.|...|.|.:|.|:.:|:...: :.|.....::.:.:::..:|::.:|.:
plant   358 LASTLDEAEISDLRDQFDAIDVDKNGVISLEEMRQALAKDLPWKLKDSRVAEILEAIDSNTDGLV 422

  Fly    65 DFPEFL--TMMARKMKDTDSEE---EIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDE 124
            ||.||:  .:...::::.|||:   ..|.||..||.|.:|:|:..||| :.|.|     ...:|.
plant   423 DFTEFVAAALHVHQLEEHDSEKWQLRSRAAFEKFDLDKDGYITPEELR-MHTGL-----RGSIDP 481

  Fly   125 MIREADIDGDGQVNYEEF 142
            ::.|||||.||:::..||
plant   482 LLDEADIDRDGKISLHEF 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 43/148 (29%)
CPK28NP_201422.1 STKc_CAMK 61..321 CDD:270687
FRQ1 346..502 CDD:227455 43/148 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.