DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CBL2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001332655.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:151 Identity:34/151 - (22%)
Similarity:72/151 - (47%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAEFKEAFSLFDKDG-----DGTITTKELGTVMRSLGQNPTEAELQDMINEV-DADGNGTIDFPE 68
            ::|.:..:.||.|..     ||.|..:|....:  ...|..|:...|.:.:: |...||.:.|.|
plant    44 VSEIEALYELFKKISSAVIDDGLINKEEFQLAL--FKTNKKESLFADRVFDLFDTKHNGILGFEE 106

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMT--------NLGEKLTDEEVDEM 125
            |...::....:...:::|..:|:::|....|||...|::.::.        ||.:.:.::.:|:.
plant   107 FARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKT 171

  Fly   126 IREADIDGDGQVNYEEFVTMM 146
            ..|||...||:::.||:.:::
plant   172 FEEADTKHDGKIDKEEWRSLV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 34/151 (23%)
CBL2NP_001332655.1 FRQ1 36..198 CDD:227455 34/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.