powered by:
Protein Alignment Cam and AIF1L
DIOPT Version :9
Sequence 1: | NP_001246276.1 |
Gene: | Cam / 36329 |
FlyBaseID: | FBgn0000253 |
Length: | 149 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001172024.1 |
Gene: | AIF1L / 83543 |
HGNCID: | 28904 |
Length: | 176 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 24/69 - (34%) |
Similarity: | 37/69 - (53%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTM 72
|::..|||.:..||.:.:|.|....|..:|..||...|..|::.||:||....:.||.:.:|:.|
Human 73 EKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNM 137
Fly 73 MARK 76
|..|
Human 138 MLGK 141
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cam | NP_001246276.1 |
PTZ00184 |
1..149 |
CDD:185504 |
24/69 (35%) |
AIF1L | NP_001172024.1 |
EFh |
78..138 |
CDD:238008 |
20/59 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.