DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CDPK9

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_197748.1 Gene:CDPK9 / 832424 AraportID:AT5G23580 Length:490 Species:Arabidopsis thaliana


Alignment Length:148 Identity:62/148 - (41%)
Similarity:91/148 - (61%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            :|::|:||:|...||.|.:.|.|..||||.:||...||.:|....|:|:|:::...|.|.:||||
plant   316 IAERLSEEEIGGLKELFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAADVDESGTID 380

  Fly    66 FPEFL--TMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128
            :.|||  |:...|:   :.||.:..||..||||.:|:|:..||:......|  :.|..:||||::
plant   381 YGEFLAATIHLNKL---EREENLVAAFSFFDKDASGYITIEELQQAWKEFG--INDSNLDEMIKD 440

  Fly   129 ADIDGDGQVNYEEFVTMM 146
            .|.|.|||::|.|||.||
plant   441 IDQDNDGQIDYGEFVAMM 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 62/148 (42%)
CDPK9NP_197748.1 STKc_CAMK 21..279 CDD:270687
Pkinase 22..280 CDD:278497
PTZ00184 316..458 CDD:185504 60/146 (41%)
EFh 328..387 CDD:238008 26/58 (45%)
EFh 400..459 CDD:238008 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.