DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AT5G04170

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_196037.2 Gene:AT5G04170 / 830295 AraportID:AT5G04170 Length:354 Species:Arabidopsis thaliana


Alignment Length:137 Identity:33/137 - (24%)
Similarity:53/137 - (38%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD 81
            |...|:||.|.|..|||...:.|..|..:..               |:....:|...:..||...
plant   192 FQAADQDGSGFIDDKELQGALSSYQQRFSMR---------------TVHLLMYLFTNSNAMKIGP 241

  Fly    82 SE--------EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG--DGQ 136
            .|        :..|..|...|||.:|.|...|||..:.:||..::...:|.::.:.|..|  :..
plant   242 KEFTALFYSLQNWRSIFERSDKDRSGRIDVNELRDALLSLGFSVSPVVLDLLVSKFDKSGGKNRA 306

  Fly   137 VNYEEFV 143
            :.|:.|:
plant   307 IEYDNFI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 33/137 (24%)
AT5G04170NP_196037.2 PHA03418 <34..>150 CDD:177646
EF-hand_7 191..278 CDD:290234 26/100 (26%)
EFh 196..278 CDD:238008 25/96 (26%)
EF-hand_7 255..314 CDD:290234 17/59 (29%)
EFh 255..314 CDD:238008 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.