DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CPK18

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001190932.1 Gene:CPK18 / 829763 AraportID:AT4G36070 Length:561 Species:Arabidopsis thaliana


Alignment Length:154 Identity:42/154 - (27%)
Similarity:87/154 - (56%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDADGNGTI 64
            :|..:.|:::.:.::.|...|.|.:|:|:.:|:...: :.:.....:|.:.:::...|::.:|.:
plant   367 LAKTINEDELDDLRDQFDAIDIDKNGSISLEEMRQALAKDVPWKLKDARVAEILQANDSNTDGLV 431

  Fly    65 DFPEFL--TMMARKMKDTDSE---EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDE 124
            ||.||:  .:...::::.|||   :..|.||..||.||:|||:..||| :.|.|     ...::.
plant   432 DFTEFVVAALHVNQLEEHDSEKWQQRSRAAFDKFDIDGDGFITPEELR-LQTGL-----KGSIEP 490

  Fly   125 MIREADIDGDGQVNYEEFVTMMTS 148
            ::.|||:|.||:::..||..::.|
plant   491 LLEEADVDEDGRISINEFRRLLRS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 42/154 (27%)
CPK18NP_001190932.1 STKc_CAMK 70..330 CDD:270687
S_TKc 71..331 CDD:214567
PTZ00184 367..514 CDD:185504 41/152 (27%)
EFh 378..437 CDD:238008 12/58 (21%)
EFh 459..513 CDD:238008 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.