DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CAM3

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_191239.1 Gene:CAM3 / 824847 AraportID:AT3G56800 Length:149 Species:Arabidopsis thaliana


Alignment Length:149 Identity:133/149 - (89%)
Similarity:144/149 - (96%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            ||||||::||:|||||||||||||||.||||||||||||||||||||||||||||||||||||||
plant     1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |||||.:|||||||||||||::|||||||||.|||||||||||||||||||||||||||||:|||
plant    66 FPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEAD 130

  Fly   131 IDGDGQVNYEEFVTMMTSK 149
            :|||||:||||||.:|.:|
plant   131 VDGDGQINYEEFVKVMMAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 132/147 (90%)
CAM3NP_191239.1 PTZ00184 1..149 CDD:185504 132/147 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1856
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I893
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm3085
orthoMCL 1 0.900 - - OOG6_100851
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.