DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CML41

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_190646.1 Gene:CML41 / 824241 AraportID:AT3G50770 Length:205 Species:Arabidopsis thaliana


Alignment Length:141 Identity:52/141 - (36%)
Similarity:84/141 - (59%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76
            |.::.||.||.||||.|:..||.....|:|:..:....|:.|||||.|.:|::.|.:|:.:|.|:
plant    64 ELRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDADGSLGFEDFVGLMTRR 128

  Fly    77 ----MKDTDSEEEIREAFRVFD-KDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ 136
                ..:.|.:.|::.||.:|: :.|:|.|:...|:.::..|||..|..|.:.||:..||||:|.
plant   129 DLYGDGEVDGDGELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFYDIDGNGI 193

  Fly   137 VNYEEFVTMMT 147
            :::.||..|||
plant   194 LDFHEFRQMMT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 52/141 (37%)
CML41NP_190646.1 PTZ00184 54..204 CDD:185504 50/139 (36%)
EFh 64..126 CDD:238008 24/61 (39%)
EFh 141..204 CDD:238008 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.